PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 335aa    MW: 35744.5 Da    PI: 4.3225
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03452genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.7e-382580661
    zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  EMT03452 25 PNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 80
              58***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-36779IPR003851Zinc finger, Dof-type
PfamPF027018.5E-322579IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8542579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MLPYVPRPPS LLVDRRYSTG AEVAPNCPRC DSPNTKFCYY NNYSLSQPRY FCKGCRRYWT  60
KGGSLRNVPV GGGCRKNRRG KSSVRSASDS FSGVRDATFG HGGFPGPLRP DMVLEGMVGN  120
PANPGQGMHD VPTAPDGSSI DLAMLYSKFL NNQQPAGDGN LVGSVTPESA GGHVDETFDT  180
FSASSDMSPS GLLPPAQFDA SPDGFVDWSR PFDASPDGFV DWSRPVSSAD PTSTASPATA  240
TTMLCTDESV QAALGELNFA MDQSCFDSLG LPTDGAAANL SSWCSIVPSL STWEEPKYDS  300
LDSFPDDTLS LHDGILAADH DWSADCQGLE ALYMP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970693.11e-161PREDICTED: uncharacterized protein LOC101752604
TrEMBLR7W5550.0R7W555_AEGTA; Dof zinc finger protein
STRINGMLOC_61071.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-38Dof family protein